KEGG   Phocoena phocoena (harbor porpoise): 136122026
Entry
136122026         CDS       T11058                                 
Symbol
TIGIT
Name
(RefSeq) T-cell immunoreceptor with Ig and ITIM domains
  KO
K16350  T-cell immunoreceptor with Ig and ITIM domains
Organism
pphc  Phocoena phocoena (harbor porpoise)
Pathway
pphc04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:pphc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    136122026 (TIGIT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pphc04515]
    136122026 (TIGIT)
Cell adhesion molecules [BR:pphc04515]
 Immunoglobulin superfamily
  L1 family
   136122026 (TIGIT)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 CAAX_1
Other DBs
NCBI-GeneID: 136122026
NCBI-ProteinID: XP_065731931
LinkDB
Position
4:complement(85728082..85743346)
AA seq 249 aa
MQWCLLLLWAQGLRQALLPASGAVTGRIVTTGNISAEEGGSVTLQCHLSSTTAKVTQVNW
KQQDQVLAIHHASLGWHIDPAFTERMVPGPNLGLTLQSLTRNDTGEYVCIYHTYPDGIYK
GTVFLEVLQSSVAEHSAGFQIPLLGAMATVLAVIGTAVIVVLTLARKFFCFWKKSLRIRS
AEGGLGRRLSEQEEWRPGVLSSPGSCVRADAGLCREQPGEDRAEPEPHDYFNVLSYRSLA
SFSVPAEEG
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcagtggtgtctcctactgctctgggcccaggggctgaggcaggctctcctccctgcc
tcaggagctgtgacaggcagaatagtaacaacggggaacatttctgcagaggaaggtggc
tctgtcaccttacaatgtcacctctcctccactactgccaaagtgacccaggtcaactgg
aaacagcaggaccaagttttggccattcatcatgccagcctggggtggcacatcgaccca
gccttcacggagcgaatggtcccaggccccaacctgggcctcaccctccagtcactgacc
aggaacgacacaggagagtacgtctgcatctatcacacctaccctgatggcatttacaaa
gggacagtctttctggaagtcctacaaagctcagtggctgagcacagcgctgggttccag
atcccactgcttggagccatggccacagtgctggcagtcatcggcacagcagtcattgtg
gtgctcacactggccagaaagtttttttgtttttggaagaaatctctcagaatccgttct
gcggaaggtggcctcgggaggaggctgtctgaacaggaggagtggaggcccggcgtcctg
tcctccccgggcagctgtgtgcgtgcggacgccggcctctgcagggagcagccgggagag
gaccgcgcagagcccgagccgcacgactacttcaacgtcttgagttacagaagcctcgcg
agcttcagcgtccccgccgaggagggctag

DBGET integrated database retrieval system