Phocoena phocoena (harbor porpoise): 136122718 Help Entry 136122718         CDS       T11058                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism pphc  Phocoena phocoena (harbor porpoise) Brite KEGG Orthology (KO) [BR:pphc00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pphc01002]     136122718 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136122718 (CSTB) Peptidases and inhibitors [BR:pphc01002]  Peptidase inhibitors   Family I25: cystatin family    136122718 (CSTB) Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    136122718 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin DUF5065 Motif Other DBs NCBI-GeneID:  136122718 NCBI-ProteinID:  XP_065732861 LinkDB All DBs Position 4:complement(144389447..144393076) Genome browser AA seq 97 aa AA seqDB search MMCGAPTPTQPATADTQAIADQVRAQLEEKEKKFPMFKAVEFKSQVVAGRVFFIKVQVDD DNFVHIRVFESLPHENKPLALASYQTHKGRHDELTYF NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggcgcgcccacccccacgcagccggccacggcagacacccaggccatcgcc gaccaggtgagggcccagctggaagagaaggagaagaagttcccgatgttcaaggctgtg gagttcaagagccaggtggtcgccgggagggtcttcttcatcaaggttcaagtggatgat gacaacttcgtgcacattcgagtatttgaaagcctcccacatgagaacaagcccttggcc ttggccagctaccagacccacaaaggcagacacgacgagctgacctacttctag

DBGET integrated database retrieval system