Phocoena phocoena (harbor porpoise): 136122800 Help Entry 136122800         CDS       T11058                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04146   Peroxisome pphc04213   Longevity regulating pathway - multiple species pphc05012   Parkinson disease pphc05014   Amyotrophic lateral sclerosis pphc05016   Huntington disease pphc05020   Prion disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pphc00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     136122800 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     136122800 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     136122800 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     136122800 (SOD1)    05014 Amyotrophic lateral sclerosis     136122800 (SOD1)    05016 Huntington disease     136122800 (SOD1)    05020 Prion disease     136122800 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     136122800 (SOD1) Enzymes [BR:pphc01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      136122800 (SOD1) SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  136122800 NCBI-ProteinID:  XP_065732972 LinkDB All DBs Position 4:133541016..133548631 Genome browser AA seq 153 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEQKEDGTVVVSGSITGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPEDEERHVGDLGNVKADQNGVAEVCIEDSIISLCGDHSIIGRTMVVH EKPDDLGRGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtgtgcgtgctgaagggcgacggcccggtgcagggtaccatccac ttcgaacaaaaggaagatgggacggtcgtggtatcgggatccattacaggattgactgaa ggcgatcatggattccatgtccatcaatttggagataatacacaaggctgtaccagtgca ggtcctcactttaaccctctatccaaaaaacacggtgggccagaggatgaagagaggcat gttggagacctgggcaatgtgaaggctgaccaaaatggtgtggccgaagtgtgtattgaa gattctataatctcactctgtggagaccattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagacaggaaacgct ggaagtcgtttggcctgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system