Phocoena phocoena (harbor porpoise): 136123467 Help Entry 136123467         CDS       T11058                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04151   PI3K-Akt signaling pathway pphc04625   C-type lectin receptor signaling pathway pphc04630   JAK-STAT signaling pathway pphc04658   Th1 and Th2 cell differentiation pphc04659   Th17 cell differentiation pphc04660   T cell receptor signaling pathway pphc04672   Intestinal immune network for IgA production pphc04940   Type I diabetes mellitus pphc05135   Yersinia infection pphc05142   Chagas disease pphc05162   Measles pphc05166   Human T-cell leukemia virus 1 infection pphc05171   Coronavirus disease - COVID-19 pphc05200   Pathways in cancer pphc05320   Autoimmune thyroid disease pphc05321   Inflammatory bowel disease pphc05330   Allograft rejection pphc05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136123467 (IL2)    04151 PI3K-Akt signaling pathway     136123467 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136123467 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     136123467 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136123467 (IL2)    04660 T cell receptor signaling pathway     136123467 (IL2)    04658 Th1 and Th2 cell differentiation     136123467 (IL2)    04659 Th17 cell differentiation     136123467 (IL2)    04672 Intestinal immune network for IgA production     136123467 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136123467 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136123467 (IL2)    05171 Coronavirus disease - COVID-19     136123467 (IL2)    05162 Measles     136123467 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     136123467 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     136123467 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     136123467 (IL2)    05321 Inflammatory bowel disease     136123467 (IL2)    05330 Allograft rejection     136123467 (IL2)    05332 Graft-versus-host disease     136123467 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     136123467 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136123467 (IL2)    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136123467 (IL2) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Interleukins    136123467 (IL2) Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Cytokines    136123467 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  136123467 NCBI-ProteinID:  XP_065733796 LinkDB All DBs Position 5:complement(120477340..120482612) Genome browser AA seq 154 aa AA seqDB search MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRML TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS ETRFSCEYDDETVTAVELLNKWITFCQSIYSTMT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatgcaactcttgtcttgcattgcactaactcttgcacttgtggcaaacggt gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat ttacatttgcttttgaaggaaattaataattacgagaacctcaagctcttcaggatgctc acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg atagatatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct gaaacaagattctcatgtgaatatgatgatgagacagtaaccgctgtagaacttctgaac aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system