Phocoena phocoena (harbor porpoise): 136124416 Help Entry 136124416         CDS       T11058                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04151   PI3K-Akt signaling pathway pphc04217   Necroptosis pphc04620   Toll-like receptor signaling pathway pphc04621   NOD-like receptor signaling pathway pphc04622   RIG-I-like receptor signaling pathway pphc04623   Cytosolic DNA-sensing pathway pphc04630   JAK-STAT signaling pathway pphc04650   Natural killer cell mediated cytotoxicity pphc04936   Alcoholic liver disease pphc05152   Tuberculosis pphc05160   Hepatitis C pphc05161   Hepatitis B pphc05162   Measles pphc05163   Human cytomegalovirus infection pphc05164   Influenza A pphc05165   Human papillomavirus infection pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05168   Herpes simplex virus 1 infection pphc05169   Epstein-Barr virus infection pphc05170   Human immunodeficiency virus 1 infection pphc05171   Coronavirus disease - COVID-19 pphc05200   Pathways in cancer pphc05320   Autoimmune thyroid disease pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     136124416    04151 PI3K-Akt signaling pathway     136124416   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136124416  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136124416  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136124416    04621 NOD-like receptor signaling pathway     136124416    04622 RIG-I-like receptor signaling pathway     136124416    04623 Cytosolic DNA-sensing pathway     136124416    04650 Natural killer cell mediated cytotoxicity     136124416  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136124416   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136124416    05161 Hepatitis B     136124416    05160 Hepatitis C     136124416    05171 Coronavirus disease - COVID-19     136124416    05164 Influenza A     136124416    05162 Measles     136124416    05168 Herpes simplex virus 1 infection     136124416    05163 Human cytomegalovirus infection     136124416    05167 Kaposi sarcoma-associated herpesvirus infection     136124416    05169 Epstein-Barr virus infection     136124416    05165 Human papillomavirus infection     136124416   09171 Infectious disease: bacterial    05152 Tuberculosis     136124416   09163 Immune disease    05320 Autoimmune thyroid disease     136124416   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136124416   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     136124416  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136124416 Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Interferons    136124416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  136124416 NCBI-ProteinID:  XP_065735197 LinkDB All DBs Position 6:45564693..45565262 Genome browser AA seq 189 aa AA seqDB search MAPTVSLLLALVLLSCNSNCSLGCDLPQTHSLTNTRALMLLQQMRRISPFSCLKDRNDFG FPQDAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQ ACLMQEAGPEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQESLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaaccgtgtccttactcctggccctggtgctactcagctgcaactccaactgc tctctgggctgcgacctgcctcagacccacagcctgacgaacacgagggccctgatgctc ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggacgcgtttggaggcaaccagttccagaaggctcaagccatcgctgtcgtc catgagatgatccagcagaccttccagctcttcagcacagagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcactgcactttatcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggccggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaagtacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagcctcaggaggaaggaatga

DBGET integrated database retrieval system