Phocoena phocoena (harbor porpoise): 136124729 Help Entry 136124729         CDS       T11058                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136124729 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     136124729 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     136124729 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136124729 (CCL27) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Chemokines    136124729 (CCL27) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  136124729 NCBI-ProteinID:  XP_065735589 LinkDB All DBs Position 6:34333060..34333659 Genome browser AA seq 88 aa AA seqDB search MKGPSPTSSLLLLLLLLSPDPGGALPLAPSTTSCCTQFYRQPLSSKLLRNIIRVEFQEAD GDCHLQAFLFHLSRRSVCIHPQNRSLTL NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaggggccctcgcccaccagcagcctcctgctgctactgttgctcctaagcccagac cctggaggagcattgccactggcacccagcactacatcatgctgtactcagttctaccga cagccactctcaagcaaactactgaggaacatcatccgagtggaatttcaggaagctgat ggggactgtcacctccaggccttcttgtttcacctgtctcgacgcagcgtctgcatccac ccccagaaccgcagcctgactctgtga

DBGET integrated database retrieval system