Phocoena phocoena (harbor porpoise): 136124730 Help Entry 136124730         CDS       T11058                                  Name (RefSeq) uncharacterized protein   KO K16598   C-C motif chemokine 27 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136124730    04061 Viral protein interaction with cytokine and cytokine receptor     136124730  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     136124730  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136124730 Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Chemokines    136124730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  136124730 NCBI-ProteinID:  XP_065735590 LinkDB All DBs Position 6:34328774..34329799 Genome browser AA seq 87 aa AA seqDB search MSGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPREQKLEPLRGLMSCLSSGLG TAPQRSGRSLPRRTPAATAQPSGALKI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcgggattgaggagatacgaggtggcgctggaggctgaggaggagatctactggggc tgtttctactttttcccctggctgcgcatgtggcgaagggagcggagctcagcgcaccct cgggagcagaagctggagcctctgcggggcctgatgagctgtctgtcaagtggactgggc actgctccccagcgctccggtcgcagcctcccccgccgcacccccgctgccactgcccag ccatctggtgcattaaagatttaa

DBGET integrated database retrieval system