Phocoena phocoena (harbor porpoise): 136125894 Help Entry 136125894         CDS       T11058                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01521   EGFR tyrosine kinase inhibitor resistance pphc01522   Endocrine resistance pphc04010   MAPK signaling pathway pphc04012   ErbB signaling pathway pphc04014   Ras signaling pathway pphc04015   Rap1 signaling pathway pphc04062   Chemokine signaling pathway pphc04068   FoxO signaling pathway pphc04071   Sphingolipid signaling pathway pphc04072   Phospholipase D signaling pathway pphc04137   Mitophagy - animal pphc04140   Autophagy - animal pphc04150   mTOR signaling pathway pphc04151   PI3K-Akt signaling pathway pphc04210   Apoptosis pphc04211   Longevity regulating pathway pphc04213   Longevity regulating pathway - multiple species pphc04218   Cellular senescence pphc04360   Axon guidance pphc04370   VEGF signaling pathway pphc04371   Apelin signaling pathway pphc04540   Gap junction pphc04550   Signaling pathways regulating pluripotency of stem cells pphc04625   C-type lectin receptor signaling pathway pphc04650   Natural killer cell mediated cytotoxicity pphc04660   T cell receptor signaling pathway pphc04662   B cell receptor signaling pathway pphc04664   Fc epsilon RI signaling pathway pphc04714   Thermogenesis pphc04720   Long-term potentiation pphc04722   Neurotrophin signaling pathway pphc04725   Cholinergic synapse pphc04726   Serotonergic synapse pphc04730   Long-term depression pphc04810   Regulation of actin cytoskeleton pphc04910   Insulin signaling pathway pphc04912   GnRH signaling pathway pphc04915   Estrogen signaling pathway pphc04916   Melanogenesis pphc04917   Prolactin signaling pathway pphc04919   Thyroid hormone signaling pathway pphc04921   Oxytocin signaling pathway pphc04926   Relaxin signaling pathway pphc04929   GnRH secretion pphc04933   AGE-RAGE signaling pathway in diabetic complications pphc04935   Growth hormone synthesis, secretion and action pphc05010   Alzheimer disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05034   Alcoholism pphc05160   Hepatitis C pphc05161   Hepatitis B pphc05163   Human cytomegalovirus infection pphc05165   Human papillomavirus infection pphc05166   Human T-cell leukemia virus 1 infection pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05170   Human immunodeficiency virus 1 infection pphc05200   Pathways in cancer pphc05203   Viral carcinogenesis pphc05205   Proteoglycans in cancer pphc05206   MicroRNAs in cancer pphc05207   Chemical carcinogenesis - receptor activation pphc05208   Chemical carcinogenesis - reactive oxygen species pphc05210   Colorectal cancer pphc05211   Renal cell carcinoma pphc05213   Endometrial cancer pphc05214   Glioma pphc05215   Prostate cancer pphc05216   Thyroid cancer pphc05218   Melanoma pphc05219   Bladder cancer pphc05220   Chronic myeloid leukemia pphc05221   Acute myeloid leukemia pphc05223   Non-small cell lung cancer pphc05224   Breast cancer pphc05225   Hepatocellular carcinoma pphc05226   Gastric cancer pphc05230   Central carbon metabolism in cancer pphc05231   Choline metabolism in cancer pphc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136125894 (NRAS)    04012 ErbB signaling pathway     136125894 (NRAS)    04014 Ras signaling pathway     136125894 (NRAS)    04015 Rap1 signaling pathway     136125894 (NRAS)    04370 VEGF signaling pathway     136125894 (NRAS)    04371 Apelin signaling pathway     136125894 (NRAS)    04068 FoxO signaling pathway     136125894 (NRAS)    04072 Phospholipase D signaling pathway     136125894 (NRAS)    04071 Sphingolipid signaling pathway     136125894 (NRAS)    04151 PI3K-Akt signaling pathway     136125894 (NRAS)    04150 mTOR signaling pathway     136125894 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136125894 (NRAS)    04137 Mitophagy - animal     136125894 (NRAS)   09143 Cell growth and death    04210 Apoptosis     136125894 (NRAS)    04218 Cellular senescence     136125894 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     136125894 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     136125894 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136125894 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136125894 (NRAS)    04650 Natural killer cell mediated cytotoxicity     136125894 (NRAS)    04660 T cell receptor signaling pathway     136125894 (NRAS)    04662 B cell receptor signaling pathway     136125894 (NRAS)    04664 Fc epsilon RI signaling pathway     136125894 (NRAS)    04062 Chemokine signaling pathway     136125894 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     136125894 (NRAS)    04929 GnRH secretion     136125894 (NRAS)    04912 GnRH signaling pathway     136125894 (NRAS)    04915 Estrogen signaling pathway     136125894 (NRAS)    04917 Prolactin signaling pathway     136125894 (NRAS)    04921 Oxytocin signaling pathway     136125894 (NRAS)    04926 Relaxin signaling pathway     136125894 (NRAS)    04935 Growth hormone synthesis, secretion and action     136125894 (NRAS)    04919 Thyroid hormone signaling pathway     136125894 (NRAS)    04916 Melanogenesis     136125894 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     136125894 (NRAS)    04726 Serotonergic synapse     136125894 (NRAS)    04720 Long-term potentiation     136125894 (NRAS)    04730 Long-term depression     136125894 (NRAS)    04722 Neurotrophin signaling pathway     136125894 (NRAS)   09158 Development and regeneration    04360 Axon guidance     136125894 (NRAS)   09149 Aging    04211 Longevity regulating pathway     136125894 (NRAS)    04213 Longevity regulating pathway - multiple species     136125894 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     136125894 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136125894 (NRAS)    05206 MicroRNAs in cancer     136125894 (NRAS)    05205 Proteoglycans in cancer     136125894 (NRAS)    05207 Chemical carcinogenesis - receptor activation     136125894 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     136125894 (NRAS)    05203 Viral carcinogenesis     136125894 (NRAS)    05230 Central carbon metabolism in cancer     136125894 (NRAS)    05231 Choline metabolism in cancer     136125894 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     136125894 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     136125894 (NRAS)    05225 Hepatocellular carcinoma     136125894 (NRAS)    05226 Gastric cancer     136125894 (NRAS)    05214 Glioma     136125894 (NRAS)    05216 Thyroid cancer     136125894 (NRAS)    05221 Acute myeloid leukemia     136125894 (NRAS)    05220 Chronic myeloid leukemia     136125894 (NRAS)    05218 Melanoma     136125894 (NRAS)    05211 Renal cell carcinoma     136125894 (NRAS)    05219 Bladder cancer     136125894 (NRAS)    05215 Prostate cancer     136125894 (NRAS)    05213 Endometrial cancer     136125894 (NRAS)    05224 Breast cancer     136125894 (NRAS)    05223 Non-small cell lung cancer     136125894 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136125894 (NRAS)    05170 Human immunodeficiency virus 1 infection     136125894 (NRAS)    05161 Hepatitis B     136125894 (NRAS)    05160 Hepatitis C     136125894 (NRAS)    05163 Human cytomegalovirus infection     136125894 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     136125894 (NRAS)    05165 Human papillomavirus infection     136125894 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     136125894 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     136125894 (NRAS)   09165 Substance dependence    05034 Alcoholism     136125894 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136125894 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     136125894 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136125894 (NRAS)    01522 Endocrine resistance     136125894 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pphc04131]     136125894 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136125894 (NRAS)    04031 GTP-binding proteins [BR:pphc04031]     136125894 (NRAS) Membrane trafficking [BR:pphc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     136125894 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     136125894 (NRAS) Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136125894 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    136125894 (NRAS)   Exosomal proteins of breast cancer cells    136125894 (NRAS)   Exosomal proteins of colorectal cancer cells    136125894 (NRAS) GTP-binding proteins [BR:pphc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     136125894 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  136125894 NCBI-ProteinID:  XP_065736963 LinkDB All DBs Position 1:complement(101475332..101485377) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system