Phocoena phocoena (harbor porpoise): 136126687 Help Entry 136126687         CDS       T11058                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04360   Axon guidance pphc04666   Fc gamma R-mediated phagosome formation pphc04810   Regulation of actin cytoskeleton pphc05133   Pertussis pphc05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:pphc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136126687 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     136126687 (CFL1)   09158 Development and regeneration    04360 Axon guidance     136126687 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136126687 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     136126687 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pphc04131]     136126687 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pphc04812]     136126687 (CFL1)    04147 Exosome [BR:pphc04147]     136126687 (CFL1) Membrane trafficking [BR:pphc04131]  Others   Actin-binding proteins    Others     136126687 (CFL1) Cytoskeleton proteins [BR:pphc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      136126687 (CFL1) Exosome [BR:pphc04147]  Exosomal proteins   Proteins found in most exosomes    136126687 (CFL1) SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  136126687 NCBI-ProteinID:  XP_065738106 LinkDB All DBs Position 8:complement(103440176..103443737) Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggggtcatcaaagtgttcaacgacatgaaggtg cgtaagtcgtcgacaccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agcgaggacaagaagaacatcatcttggaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagacgacccctacaccacctttgtcaagatgctgccagacaaggactgc cgctacgccctctatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagtgtgcaccccttaagagcaaaatgatctacgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattgcaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagcgccgtcatctct ctggagggcaagcctttgtga

DBGET integrated database retrieval system