Phocoena phocoena (harbor porpoise): 136127055 Help Entry 136127055         CDS       T11058                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc00480   Glutathione metabolism pphc00980   Metabolism of xenobiotics by cytochrome P450 pphc00982   Drug metabolism - cytochrome P450 pphc00983   Drug metabolism - other enzymes pphc01100   Metabolic pathways pphc01524   Platinum drug resistance pphc05200   Pathways in cancer pphc05204   Chemical carcinogenesis - DNA adducts pphc05215   Prostate cancer pphc05225   Hepatocellular carcinoma pphc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     136127055 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     136127055 (GSTP1)    00982 Drug metabolism - cytochrome P450     136127055 (GSTP1)    00983 Drug metabolism - other enzymes     136127055 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136127055 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     136127055 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     136127055 (GSTP1)    05215 Prostate cancer     136127055 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     136127055 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     136127055 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pphc02000]     136127055 (GSTP1) Enzymes [BR:pphc01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      136127055 (GSTP1) Transporters [BR:pphc02000]  Other transporters   Pores ion channels [TC:1]    136127055 (GSTP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  136127055 NCBI-ProteinID:  XP_065738543 LinkDB All DBs Position 8:104801358..104803954 Genome browser AA seq 228 aa AA seqDB search MRPAGPPHFLPHLHSAAVMPPYTIVYFPTRGRCEALRMLLADQGQSWKEEVVTKESWLQG PLKASCLYGQLPKFQDGDLILYQSNAILRHLGRSFGLYGKDQREAALVDMVNDGVEDLRR HCSHIIHHGHEEDKAQYVLELPGHLKPFESLLSQNRGGQAFIVGDQISFADYNLLDLLLS HQVLVPGCLDSFPLLSAYVARLSARPKLQAFLASPEHVNRPIFGSRKI NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atgaggcctgcgggtcctccccacttcctgccgcacttgcactccgccgccgtcatgccg ccctacaccatcgtctacttcccgacccgagggcgctgtgaggccttgcgcatgctgctg gccgaccagggccagagctggaaggaggaggtggtgaccaaggagtcctggttgcagggc ccactcaaggcctcctgtctgtacgggcagctccccaagttccaggatggagacctcatt ctgtaccagtccaatgccatcctgcgacacctgggccgctcctttgggctctacggcaaa gaccagcgagaggcggcgctggtggacatggtgaacgacggtgtggaggacctccgcagg cactgcagccacatcatccatcacggccatgaggaggacaaggcccagtatgttctggag ctgccggggcacctgaagccttttgagagcctgctgtcccagaaccgagggggccaggcc ttcatcgtgggtgaccagatctccttcgccgactacaacctgctggacctgctgctgagc caccaggtcctggtccccggctgcctggactccttccccctgctctcggcctacgtggcc cgcctcagcgcccggcccaagctgcaggccttcctggcctccccggagcacgtgaaccgc cccatctttggaagccgcaagatatga

DBGET integrated database retrieval system