Phocoena phocoena (harbor porpoise): 136127870 Help Entry 136127870         CDS       T11058                                  Symbol H2BK1 Name (RefSeq) histone H2B type 2-K1   KO K11252   histone H2B Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05203   Viral carcinogenesis pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136127870 (H2BK1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     136127870 (H2BK1)   09163 Immune disease    05322 Systemic lupus erythematosus     136127870 (H2BK1)   09165 Substance dependence    05034 Alcoholism     136127870 (H2BK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136127870 (H2BK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136127870 (H2BK1) Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136127870 (H2BK1) Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136127870 (H2BK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TAF DUF6246 Motif Other DBs NCBI-GeneID:  136127870 NCBI-ProteinID:  XP_065739604 LinkDB All DBs Position 9:complement(100198765..100201064) Genome browser AA seq 122 aa AA seqDB search MSAEHGQPQQSGGRRGRSSGDKKSKKRSRRKETYSMYIYKVLKQVHPDIGISSKAMNIMN SFVNDVFERLAGEAARLAQYSGRTTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgagcatggacagccacagcagtccgggggccggaggggccggagctctgga gacaagaagtccaaaaagcgtagccggcgcaaagaaacctactcaatgtatatctacaag gtgctgaagcaggtgcaccccgacatcggcatttcctccaaggccatgaacatcatgaat tccttcgtgaacgatgtgtttgagcggctggccggagaggccgcccggctggcccagtac tcgggccgaaccacgctgacgtcccgggaaatccagacagctgtgcgtctgctgcttcca ggggagctggccaagcacgctgtgtctgagggcaccaaggccgtcaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system