Phocoena phocoena (harbor porpoise): 136128067 Help Entry 136128067         CDS       T11058                                  Symbol H2AZ2 Name (RefSeq) histone H2A.V isoform X1   KO K11251   histone H2A Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03082   ATP-dependent chromatin remodeling pphc04217   Necroptosis pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136128067 (H2AZ2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136128067 (H2AZ2)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136128067 (H2AZ2)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     136128067 (H2AZ2)   09165 Substance dependence    05034 Alcoholism     136128067 (H2AZ2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136128067 (H2AZ2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136128067 (H2AZ2) Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136128067 (H2AZ2) Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136128067 (H2AZ2) SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  136128067 NCBI-ProteinID:  XP_065739820 LinkDB All DBs Position 9:9228341..9239264 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaagctggaaaggacagtgggaaggccaaggctaaggcagtgtctcgc tcacagagagctgggttacagtttcctgtgggccgcatccacagacatttgaagactcgc accacaagtcacggaagggtcggtgccactgctgcagtgtacagtgccgcgattctggag tacctcactgctgaggtgctggagctggcaggtaatgcttccaaggatctcaaagttaag cggatcactccgcgccacttgcagcttgcaatccgtggtgatgaagagttggattctctt atcaaggctaccatagctgggggtggtgtgatccctcacatccacaagtctctgattgga aagaagggacagcagaaaactgcttag

DBGET integrated database retrieval system