Phocoena phocoena (harbor porpoise): 136128887 Help Entry 136128887         CDS       T11058                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04137   Mitophagy - animal pphc04140   Autophagy - animal pphc04144   Endocytosis pphc04145   Phagosome pphc04148   Efferocytosis pphc05132   Salmonella infection pphc05146   Amoebiasis pphc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pphc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     136128887 (RAB7A)    04145 Phagosome     136128887 (RAB7A)    04140 Autophagy - animal     136128887 (RAB7A)    04137 Mitophagy - animal     136128887 (RAB7A)    04148 Efferocytosis     136128887 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136128887 (RAB7A)    05152 Tuberculosis     136128887 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     136128887 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pphc04131]     136128887 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136128887 (RAB7A)    04031 GTP-binding proteins [BR:pphc04031]     136128887 (RAB7A) Membrane trafficking [BR:pphc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     136128887 (RAB7A) Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136128887 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    136128887 (RAB7A)   Exosomal proteins of colorectal cancer cells    136128887 (RAB7A)   Exosomal proteins of bladder cancer cells    136128887 (RAB7A) GTP-binding proteins [BR:pphc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     136128887 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  136128887 NCBI-ProteinID:  XP_065740969 LinkDB All DBs Position 10:1840481..1909861 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctactgaaggttatcatcctgggagattctggagtcggt aagacatcactcatgaaccagtacgtgaacaagaaattcagcaatcagtacaaagccaca ataggagcagacttcctgacaaaggaggtgatggtggacgacagactggttacgatgcag atctgggacacggccggacaggagaggttccagtctctgggtgtggccttctacagaggc gcagactgctgcgtgctggtgtttgacgtgactgcccccaacacgttcaaaaccctcgac agctggagagacgaattcctcatccaggccagtccccgggatcctgagaacttccccttc gttgtgctgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggccttccagacgattgcccggaacgcgctgaagcaggaaacggaggtg gagctgtacaatgaattccctgagcccatcaaactggacaagaacgaccgggccaaggcc tcggcagaaagctgcagctgctga

DBGET integrated database retrieval system