Phocoena phocoena (harbor porpoise): 136129069 Help Entry 136129069         CDS       T11058                                  Symbol H2AC17 Name (RefSeq) histone H2A type 1   KO K11251   histone H2A Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03082   ATP-dependent chromatin remodeling pphc04217   Necroptosis pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136129069 (H2AC17)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136129069 (H2AC17)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136129069 (H2AC17)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     136129069 (H2AC17)   09165 Substance dependence    05034 Alcoholism     136129069 (H2AC17)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136129069 (H2AC17)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136129069 (H2AC17) Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136129069 (H2AC17) Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136129069 (H2AC17) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  136129069 NCBI-ProteinID:  XP_065741225 LinkDB All DBs Position 10:83734482..83734874 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtgggaagcaaggcggcaaagctcgcgccaaggccaagactcgctcctcg cgggccgggctccagtttcccgtaggccgagtgcaccgcctgctccgcaaaggcaactac gccgagcgggtcggggccggcgcgccggtgtatctggccgcggtactggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaataagaagacgcgcatcatc ccgcgccacctgcagctggccatccgtaacgacgaggagctcaacaagctgctgggcaaa gtcaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag actgagagccaccacaaggccaagggcaagtaa

DBGET integrated database retrieval system