Phocoena phocoena (harbor porpoise): 136129077 Help Entry 136129077         CDS       T11058                                  Name (RefSeq) histone H2B type 1-L   KO K11252   histone H2B Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05203   Viral carcinogenesis pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136129077  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     136129077   09163 Immune disease    05322 Systemic lupus erythematosus     136129077   09165 Substance dependence    05034 Alcoholism     136129077  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136129077   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136129077 Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136129077 Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136129077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  136129077 NCBI-ProteinID:  XP_065741232 LinkDB All DBs Position 10:83747982..83748362 Genome browser AA seq 126 aa AA seqDB search MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcttgccaagtccgctcctgccccgaagaaaggctccaagaaggcggtgacc aaggctcagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctactccgta tacgtgtacaaagtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgttaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc ttgctgctgcccggcgagctggccaagcacgccgtgtctgagggcaccaaggctgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system