Phocoena phocoena (harbor porpoise): 136129137 Help Entry 136129137         CDS       T11058                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05202   Transcriptional misregulation in cancer pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136129137  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     136129137   09163 Immune disease    05322 Systemic lupus erythematosus     136129137   09165 Substance dependence    05034 Alcoholism     136129137  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136129137   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136129137 Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136129137 Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136129137 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  136129137 NCBI-ProteinID:  XP_065741321 LinkDB All DBs Position 10:84395160..84395570 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgaactaaacaaactgcgcggaagtccactggcggaaaggcgcctcgcaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccacggaa ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagttcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagcttgcccgccgtatacgcggggagagggcgtaa

DBGET integrated database retrieval system