Phocoena phocoena (harbor porpoise): 136129346 Help Entry 136129346         CDS       T11058                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05203   Viral carcinogenesis pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136129346  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     136129346   09163 Immune disease    05322 Systemic lupus erythematosus     136129346   09165 Substance dependence    05034 Alcoholism     136129346  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136129346 Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136129346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  136129346 NCBI-ProteinID:  XP_065741642 LinkDB All DBs Position 10:84388903..84389214 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggcaaaggtggtaagggattagggaaggggggcgctaagcggcatcgt aaggttttgcgcgacaacatccagggtatcaccaagcccgccatccggcgtctggcccgg cgaggtggggtcaagcgcatatctggtctgatttatgaagagacccgtggggtactgaag gtgttcttagagaatgtgatccgagacgcggtcacttacacggagcacgccaagcggaag accgtcaccgccatggacgtagtgtacgccctcaaacgccagggccgcaccctctacggc ttcggcggttag

DBGET integrated database retrieval system