Phocoena phocoena (harbor porpoise): 136129528 Help Entry 136129528         CDS       T11058                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc00190   Oxidative phosphorylation pphc01100   Metabolic pathways pphc01524   Platinum drug resistance pphc04115   p53 signaling pathway pphc04210   Apoptosis pphc04215   Apoptosis - multiple species pphc04932   Non-alcoholic fatty liver disease pphc05010   Alzheimer disease pphc05012   Parkinson disease pphc05014   Amyotrophic lateral sclerosis pphc05016   Huntington disease pphc05017   Spinocerebellar ataxia pphc05020   Prion disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05132   Salmonella infection pphc05134   Legionellosis pphc05145   Toxoplasmosis pphc05152   Tuberculosis pphc05160   Hepatitis C pphc05161   Hepatitis B pphc05162   Measles pphc05163   Human cytomegalovirus infection pphc05164   Influenza A pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05168   Herpes simplex virus 1 infection pphc05169   Epstein-Barr virus infection pphc05170   Human immunodeficiency virus 1 infection pphc05200   Pathways in cancer pphc05210   Colorectal cancer pphc05222   Small cell lung cancer pphc05416   Viral myocarditis pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     136129528  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     136129528    04215 Apoptosis - multiple species     136129528    04115 p53 signaling pathway     136129528  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136129528   09162 Cancer: specific types    05210 Colorectal cancer     136129528    05222 Small cell lung cancer     136129528   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136129528    05161 Hepatitis B     136129528    05160 Hepatitis C     136129528    05164 Influenza A     136129528    05162 Measles     136129528    05168 Herpes simplex virus 1 infection     136129528    05163 Human cytomegalovirus infection     136129528    05167 Kaposi sarcoma-associated herpesvirus infection     136129528    05169 Epstein-Barr virus infection     136129528   09171 Infectious disease: bacterial    05132 Salmonella infection     136129528    05134 Legionellosis     136129528    05152 Tuberculosis     136129528   09174 Infectious disease: parasitic    05145 Toxoplasmosis     136129528   09164 Neurodegenerative disease    05010 Alzheimer disease     136129528    05012 Parkinson disease     136129528    05014 Amyotrophic lateral sclerosis     136129528    05016 Huntington disease     136129528    05017 Spinocerebellar ataxia     136129528    05020 Prion disease     136129528    05022 Pathways of neurodegeneration - multiple diseases     136129528   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136129528    05416 Viral myocarditis     136129528   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     136129528   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     136129528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  136129528 NCBI-ProteinID:  XP_065741965 LinkDB All DBs Position 10:complement(20945986..20948905) Genome browser AA seq 191 aa AA seqDB search MRGSKAGVPSLFGIRDCFMEDNFMDRGGDGPGSNASDGVDGSTGNRRDAGDRLVGNASKG SGSNGSDGERWGVADEAALALPCSPPAGDVEKGEKIFVQKCAQCHTVEKGGKHKTGPNLH GLFGRKTGQAVGFSYTDANKNKGITWGKETLMEYLENPKKYIPGTKMIFAGIKKKGERAD LIAYLEKATNE NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcggggctccaaagcaggggtccccagccttttcggcatcagggactgtttcatggaa gacaattttatggacaggggcggggatggtcccggaagtaatgcaagcgatggggtggat ggttccaccggcaacaggagagatgcgggggatcgtttagtcggtaatgcgagcaaaggt tcaggtagcaatgggagtgacggggagcgctggggagtcgcagatgaagctgcgctagct ctcccgtgttcacctcctgctggtgatgttgagaagggagagaagatttttgttcagaag tgcgcccagtgccatactgtggaaaagggaggcaagcacaagactgggccaaatctccat ggcctgtttgggcgaaagacaggtcaggctgtcggattctcttacacagatgccaacaag aacaaaggcatcacctggggaaaggagacactgatggagtatttggagaatcccaagaag tacatccctggaacaaaaatgatcttcgctggcattaagaagaagggagaaagggcagac ttgatagcttatctcgaaaaagctactaatgagtaa

DBGET integrated database retrieval system