KEGG   Phocoena phocoena (harbor porpoise): 136132239
Entry
136132239         CDS       T11058                                 
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
  KO
K03957  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1
Organism
pphc  Phocoena phocoena (harbor porpoise)
Pathway
pphc00190  Oxidative phosphorylation
pphc01100  Metabolic pathways
pphc04714  Thermogenesis
pphc04723  Retrograde endocannabinoid signaling
pphc04932  Non-alcoholic fatty liver disease
pphc05010  Alzheimer disease
pphc05012  Parkinson disease
pphc05014  Amyotrophic lateral sclerosis
pphc05016  Huntington disease
pphc05020  Prion disease
pphc05022  Pathways of neurodegeneration - multiple diseases
pphc05208  Chemical carcinogenesis - reactive oxygen species
pphc05415  Diabetic cardiomyopathy
Module
pphc_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:pphc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    136132239
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    136132239
  09159 Environmental adaptation
   04714 Thermogenesis
    136132239
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    136132239
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    136132239
   05012 Parkinson disease
    136132239
   05014 Amyotrophic lateral sclerosis
    136132239
   05016 Huntington disease
    136132239
   05020 Prion disease
    136132239
   05022 Pathways of neurodegeneration - multiple diseases
    136132239
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    136132239
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    136132239
SSDB
Motif
Pfam: NADH_oxidored
Other DBs
NCBI-GeneID: 136132239
NCBI-ProteinID: XP_065745211
LinkDB
Position
12:52331043..52331357
AA seq 58 aa
MMNLLQIVRDHWVHILVPVGFVVGCYLDRKNDEKLIAFRNKSLLYKRELRPSEEVTWK
NT seq 177 nt   +upstreamnt  +downstreamnt
atgatgaacttacttcagattgtgcgtgaccactgggtacatatacttgtccctgtggga
tttgtcgttggatgttacctagacagaaagaatgatgaaaagctaattgccttccggaac
aagagtctgttatataaaagggaattaagacccagtgaagaagtcacctggaagtaa

DBGET integrated database retrieval system