Phocoena phocoena (harbor porpoise): 136134391 Help Entry 136134391         CDS       T11058                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc01521   EGFR tyrosine kinase inhibitor resistance pphc01524   Platinum drug resistance pphc04014   Ras signaling pathway pphc04064   NF-kappa B signaling pathway pphc04115   p53 signaling pathway pphc04137   Mitophagy - animal pphc04140   Autophagy - animal pphc04151   PI3K-Akt signaling pathway pphc04210   Apoptosis pphc04215   Apoptosis - multiple species pphc04621   NOD-like receptor signaling pathway pphc04630   JAK-STAT signaling pathway pphc05012   Parkinson disease pphc05014   Amyotrophic lateral sclerosis pphc05022   Pathways of neurodegeneration - multiple diseases pphc05145   Toxoplasmosis pphc05162   Measles pphc05166   Human T-cell leukemia virus 1 infection pphc05168   Herpes simplex virus 1 infection pphc05170   Human immunodeficiency virus 1 infection pphc05200   Pathways in cancer pphc05202   Transcriptional misregulation in cancer pphc05212   Pancreatic cancer pphc05220   Chronic myeloid leukemia pphc05222   Small cell lung cancer pphc05225   Hepatocellular carcinoma pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     136134391 (BCL2L1)    04630 JAK-STAT signaling pathway     136134391 (BCL2L1)    04064 NF-kappa B signaling pathway     136134391 (BCL2L1)    04151 PI3K-Akt signaling pathway     136134391 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136134391 (BCL2L1)    04137 Mitophagy - animal     136134391 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     136134391 (BCL2L1)    04215 Apoptosis - multiple species     136134391 (BCL2L1)    04115 p53 signaling pathway     136134391 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     136134391 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136134391 (BCL2L1)    05202 Transcriptional misregulation in cancer     136134391 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     136134391 (BCL2L1)    05225 Hepatocellular carcinoma     136134391 (BCL2L1)    05220 Chronic myeloid leukemia     136134391 (BCL2L1)    05222 Small cell lung cancer     136134391 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     136134391 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     136134391 (BCL2L1)    05162 Measles     136134391 (BCL2L1)    05168 Herpes simplex virus 1 infection     136134391 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     136134391 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     136134391 (BCL2L1)    05014 Amyotrophic lateral sclerosis     136134391 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     136134391 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136134391 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     136134391 (BCL2L1)    01524 Platinum drug resistance     136134391 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pphc01009]     136134391 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136134391 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pphc02000]     136134391 (BCL2L1) Protein phosphatases and associated proteins [BR:pphc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      136134391 (BCL2L1) Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     136134391 (BCL2L1) Transporters [BR:pphc02000]  Other transporters   Pores ion channels [TC:1]    136134391 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  136134391 NCBI-ProteinID:  XP_065747957 LinkDB All DBs Position 15:complement(61121309..61172766) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaatcgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggacgagaacagaactgaggccccagaaggg actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system