KEGG   Phocoena phocoena (harbor porpoise): 136134400
Entry
136134400         CDS       T11058                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pphc  Phocoena phocoena (harbor porpoise)
Pathway
pphc01521  EGFR tyrosine kinase inhibitor resistance
pphc01522  Endocrine resistance
pphc01524  Platinum drug resistance
pphc04010  MAPK signaling pathway
pphc04012  ErbB signaling pathway
pphc04014  Ras signaling pathway
pphc04015  Rap1 signaling pathway
pphc04022  cGMP-PKG signaling pathway
pphc04024  cAMP signaling pathway
pphc04062  Chemokine signaling pathway
pphc04066  HIF-1 signaling pathway
pphc04068  FoxO signaling pathway
pphc04071  Sphingolipid signaling pathway
pphc04072  Phospholipase D signaling pathway
pphc04114  Oocyte meiosis
pphc04140  Autophagy - animal
pphc04148  Efferocytosis
pphc04150  mTOR signaling pathway
pphc04151  PI3K-Akt signaling pathway
pphc04210  Apoptosis
pphc04218  Cellular senescence
pphc04261  Adrenergic signaling in cardiomyocytes
pphc04270  Vascular smooth muscle contraction
pphc04350  TGF-beta signaling pathway
pphc04360  Axon guidance
pphc04370  VEGF signaling pathway
pphc04371  Apelin signaling pathway
pphc04380  Osteoclast differentiation
pphc04510  Focal adhesion
pphc04517  IgSF CAM signaling
pphc04520  Adherens junction
pphc04540  Gap junction
pphc04550  Signaling pathways regulating pluripotency of stem cells
pphc04611  Platelet activation
pphc04613  Neutrophil extracellular trap formation
pphc04620  Toll-like receptor signaling pathway
pphc04621  NOD-like receptor signaling pathway
pphc04625  C-type lectin receptor signaling pathway
pphc04650  Natural killer cell mediated cytotoxicity
pphc04657  IL-17 signaling pathway
pphc04658  Th1 and Th2 cell differentiation
pphc04659  Th17 cell differentiation
pphc04660  T cell receptor signaling pathway
pphc04662  B cell receptor signaling pathway
pphc04664  Fc epsilon RI signaling pathway
pphc04666  Fc gamma R-mediated phagocytosis
pphc04668  TNF signaling pathway
pphc04713  Circadian entrainment
pphc04720  Long-term potentiation
pphc04722  Neurotrophin signaling pathway
pphc04723  Retrograde endocannabinoid signaling
pphc04724  Glutamatergic synapse
pphc04725  Cholinergic synapse
pphc04726  Serotonergic synapse
pphc04730  Long-term depression
pphc04810  Regulation of actin cytoskeleton
pphc04910  Insulin signaling pathway
pphc04912  GnRH signaling pathway
pphc04914  Progesterone-mediated oocyte maturation
pphc04915  Estrogen signaling pathway
pphc04916  Melanogenesis
pphc04917  Prolactin signaling pathway
pphc04919  Thyroid hormone signaling pathway
pphc04921  Oxytocin signaling pathway
pphc04926  Relaxin signaling pathway
pphc04928  Parathyroid hormone synthesis, secretion and action
pphc04929  GnRH secretion
pphc04930  Type II diabetes mellitus
pphc04933  AGE-RAGE signaling pathway in diabetic complications
pphc04934  Cushing syndrome
pphc04935  Growth hormone synthesis, secretion and action
pphc04960  Aldosterone-regulated sodium reabsorption
pphc05010  Alzheimer disease
pphc05020  Prion disease
pphc05022  Pathways of neurodegeneration - multiple diseases
pphc05034  Alcoholism
pphc05132  Salmonella infection
pphc05133  Pertussis
pphc05135  Yersinia infection
pphc05140  Leishmaniasis
pphc05142  Chagas disease
pphc05145  Toxoplasmosis
pphc05152  Tuberculosis
pphc05160  Hepatitis C
pphc05161  Hepatitis B
pphc05163  Human cytomegalovirus infection
pphc05164  Influenza A
pphc05165  Human papillomavirus infection
pphc05166  Human T-cell leukemia virus 1 infection
pphc05167  Kaposi sarcoma-associated herpesvirus infection
pphc05170  Human immunodeficiency virus 1 infection
pphc05171  Coronavirus disease - COVID-19
pphc05200  Pathways in cancer
pphc05203  Viral carcinogenesis
pphc05205  Proteoglycans in cancer
pphc05206  MicroRNAs in cancer
pphc05207  Chemical carcinogenesis - receptor activation
pphc05208  Chemical carcinogenesis - reactive oxygen species
pphc05210  Colorectal cancer
pphc05211  Renal cell carcinoma
pphc05212  Pancreatic cancer
pphc05213  Endometrial cancer
pphc05214  Glioma
pphc05215  Prostate cancer
pphc05216  Thyroid cancer
pphc05218  Melanoma
pphc05219  Bladder cancer
pphc05220  Chronic myeloid leukemia
pphc05221  Acute myeloid leukemia
pphc05223  Non-small cell lung cancer
pphc05224  Breast cancer
pphc05225  Hepatocellular carcinoma
pphc05226  Gastric cancer
pphc05230  Central carbon metabolism in cancer
pphc05231  Choline metabolism in cancer
pphc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pphc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pphc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    136134400 (MAPK3)
   04012 ErbB signaling pathway
    136134400 (MAPK3)
   04014 Ras signaling pathway
    136134400 (MAPK3)
   04015 Rap1 signaling pathway
    136134400 (MAPK3)
   04350 TGF-beta signaling pathway
    136134400 (MAPK3)
   04370 VEGF signaling pathway
    136134400 (MAPK3)
   04371 Apelin signaling pathway
    136134400 (MAPK3)
   04668 TNF signaling pathway
    136134400 (MAPK3)
   04066 HIF-1 signaling pathway
    136134400 (MAPK3)
   04068 FoxO signaling pathway
    136134400 (MAPK3)
   04072 Phospholipase D signaling pathway
    136134400 (MAPK3)
   04071 Sphingolipid signaling pathway
    136134400 (MAPK3)
   04024 cAMP signaling pathway
    136134400 (MAPK3)
   04022 cGMP-PKG signaling pathway
    136134400 (MAPK3)
   04151 PI3K-Akt signaling pathway
    136134400 (MAPK3)
   04150 mTOR signaling pathway
    136134400 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    136134400 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    136134400 (MAPK3)
   04148 Efferocytosis
    136134400 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    136134400 (MAPK3)
   04210 Apoptosis
    136134400 (MAPK3)
   04218 Cellular senescence
    136134400 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    136134400 (MAPK3)
   04520 Adherens junction
    136134400 (MAPK3)
   04540 Gap junction
    136134400 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    136134400 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    136134400 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    136134400 (MAPK3)
   04613 Neutrophil extracellular trap formation
    136134400 (MAPK3)
   04620 Toll-like receptor signaling pathway
    136134400 (MAPK3)
   04621 NOD-like receptor signaling pathway
    136134400 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    136134400 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    136134400 (MAPK3)
   04660 T cell receptor signaling pathway
    136134400 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    136134400 (MAPK3)
   04659 Th17 cell differentiation
    136134400 (MAPK3)
   04657 IL-17 signaling pathway
    136134400 (MAPK3)
   04662 B cell receptor signaling pathway
    136134400 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    136134400 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    136134400 (MAPK3)
   04062 Chemokine signaling pathway
    136134400 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    136134400 (MAPK3)
   04929 GnRH secretion
    136134400 (MAPK3)
   04912 GnRH signaling pathway
    136134400 (MAPK3)
   04915 Estrogen signaling pathway
    136134400 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    136134400 (MAPK3)
   04917 Prolactin signaling pathway
    136134400 (MAPK3)
   04921 Oxytocin signaling pathway
    136134400 (MAPK3)
   04926 Relaxin signaling pathway
    136134400 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    136134400 (MAPK3)
   04919 Thyroid hormone signaling pathway
    136134400 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    136134400 (MAPK3)
   04916 Melanogenesis
    136134400 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    136134400 (MAPK3)
   04270 Vascular smooth muscle contraction
    136134400 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    136134400 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    136134400 (MAPK3)
   04725 Cholinergic synapse
    136134400 (MAPK3)
   04726 Serotonergic synapse
    136134400 (MAPK3)
   04720 Long-term potentiation
    136134400 (MAPK3)
   04730 Long-term depression
    136134400 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    136134400 (MAPK3)
   04722 Neurotrophin signaling pathway
    136134400 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    136134400 (MAPK3)
   04380 Osteoclast differentiation
    136134400 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    136134400 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    136134400 (MAPK3)
   05206 MicroRNAs in cancer
    136134400 (MAPK3)
   05205 Proteoglycans in cancer
    136134400 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    136134400 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    136134400 (MAPK3)
   05203 Viral carcinogenesis
    136134400 (MAPK3)
   05230 Central carbon metabolism in cancer
    136134400 (MAPK3)
   05231 Choline metabolism in cancer
    136134400 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    136134400 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    136134400 (MAPK3)
   05212 Pancreatic cancer
    136134400 (MAPK3)
   05225 Hepatocellular carcinoma
    136134400 (MAPK3)
   05226 Gastric cancer
    136134400 (MAPK3)
   05214 Glioma
    136134400 (MAPK3)
   05216 Thyroid cancer
    136134400 (MAPK3)
   05221 Acute myeloid leukemia
    136134400 (MAPK3)
   05220 Chronic myeloid leukemia
    136134400 (MAPK3)
   05218 Melanoma
    136134400 (MAPK3)
   05211 Renal cell carcinoma
    136134400 (MAPK3)
   05219 Bladder cancer
    136134400 (MAPK3)
   05215 Prostate cancer
    136134400 (MAPK3)
   05213 Endometrial cancer
    136134400 (MAPK3)
   05224 Breast cancer
    136134400 (MAPK3)
   05223 Non-small cell lung cancer
    136134400 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    136134400 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    136134400 (MAPK3)
   05161 Hepatitis B
    136134400 (MAPK3)
   05160 Hepatitis C
    136134400 (MAPK3)
   05171 Coronavirus disease - COVID-19
    136134400 (MAPK3)
   05164 Influenza A
    136134400 (MAPK3)
   05163 Human cytomegalovirus infection
    136134400 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    136134400 (MAPK3)
   05165 Human papillomavirus infection
    136134400 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    136134400 (MAPK3)
   05135 Yersinia infection
    136134400 (MAPK3)
   05133 Pertussis
    136134400 (MAPK3)
   05152 Tuberculosis
    136134400 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    136134400 (MAPK3)
   05140 Leishmaniasis
    136134400 (MAPK3)
   05142 Chagas disease
    136134400 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    136134400 (MAPK3)
   05020 Prion disease
    136134400 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    136134400 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    136134400 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    136134400 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    136134400 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    136134400 (MAPK3)
   04934 Cushing syndrome
    136134400 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    136134400 (MAPK3)
   01524 Platinum drug resistance
    136134400 (MAPK3)
   01522 Endocrine resistance
    136134400 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pphc01001]
    136134400 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pphc03036]
    136134400 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pphc04147]
    136134400 (MAPK3)
Enzymes [BR:pphc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     136134400 (MAPK3)
Protein kinases [BR:pphc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   136134400 (MAPK3)
Chromosome and associated proteins [BR:pphc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     136134400 (MAPK3)
Exosome [BR:pphc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   136134400 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 136134400
NCBI-ProteinID: XP_065747978
LinkDB
Position
15:complement(16363034..16369637)
AA seq 400 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEVGQPPAAGPCPEPPHFFATQ
PVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLEAP
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgacggg
gtcggcccgggggtcccgggggaagtagagatagtgaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtatggcatggtcagctcagct
tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgtacgttgcgagagatccagatcttgctgcgcttccgccatgagaac
gtcatcggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac
attgtgcaagacctgatggagacagacctgtacaagttgcttaaaagccagcagctgagc
aacgaccacatctgctacttcctctaccaaatcctgcggggcctcaagtatatccattcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgattttggtcttgcccggattgccgatcctgagcacgaccacactggc
tttctgacggaatacgtggctacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttcccgggcaagcactacctggaccagctcaaccacattctgggt
atcctgggctccccctcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctaccctccaagaccaaggtggcctgggccaagctttttcccaagtcg
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcactggctcacccctacctggagcagtactacgacccaacagatgag
gtgggccagccaccagcagcgggtccctgtcctgagcctccccacttctttgccacccag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggagcgg
ctgaaggagctcatcttccaggagacagcccgtttccagcctggggtgctggaggcaccc
taa

DBGET integrated database retrieval system