Phocoena phocoena (harbor porpoise): 136134439 Help Entry 136134439         CDS       T11058                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05203   Viral carcinogenesis pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136134439  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     136134439   09163 Immune disease    05322 Systemic lupus erythematosus     136134439   09165 Substance dependence    05034 Alcoholism     136134439  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136134439   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136134439 Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136134439 Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136134439 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  136134439 NCBI-ProteinID:  XP_065748078 LinkDB All DBs Position 1:108317818..108318361 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPASKKGSKKAVTKAQKKDGRKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggcaaaatccgccccggcgtccaagaagggctcgaagaaagctgtcacc aaagcccagaagaaggacggcaggaagcgcaagcgcagccgcaaggagagctattccatc tatgtgtacaaggtactgaagcaagtgcacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaagcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system