Phocoena phocoena (harbor porpoise): 136134443 Help Entry 136134443         CDS       T11058                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04510   Focal adhesion pphc04520   Adherens junction pphc04670   Leukocyte transendothelial migration pphc04810   Regulation of actin cytoskeleton pphc04814   Motor proteins pphc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pphc00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     136134443 (MYL10)    04520 Adherens junction     136134443 (MYL10)   09142 Cell motility    04814 Motor proteins     136134443 (MYL10)    04810 Regulation of actin cytoskeleton     136134443 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     136134443 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136134443 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pphc04812]     136134443 (MYL10) Cytoskeleton proteins [BR:pphc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      136134443 (MYL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  136134443 NCBI-ProteinID:  XP_065748083 LinkDB All DBs Position 15:complement(7633515..7642123) Genome browser AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFNVFDTEGKGFVKADFIKEKLMTQADRFSEDEIKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagatccaggagtttaaagaggctttcaccatcatggaccagaac cgggatggcttcatcgacaaggaggacctgagggacacctttgctgccctgggccgcatc aatgtaaagaacgaggagctggaggccatggtgaaggaggcccccgggcccatcaacttc accgtcttcctgaccatgtttggggagaagctgaagggtacggacccagaggagaccatt ctccacgccttcaatgtgttcgacactgaagggaaaggtttcgtcaaggctgatttcatc aaagagaagctcatgacgcaggcagaccgcttcagtgaggacgagatcaagcagatgttt gctgccttcccgccagatgtgtgtggcaatctggactataggaacctgtgttacgtcatc acgcatggcgaagagaaggactaa

DBGET integrated database retrieval system