Phocoena phocoena (harbor porpoise): 136135213 Help Entry 136135213         CDS       T11058                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03008   Ribosome biogenesis in eukaryotes pphc03013   Nucleocytoplasmic transport pphc03015   mRNA surveillance pathway pphc05014   Amyotrophic lateral sclerosis pphc05164   Influenza A Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     136135213 (NXT1)    03015 mRNA surveillance pathway     136135213 (NXT1)    03008 Ribosome biogenesis in eukaryotes     136135213 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     136135213 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136135213 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pphc03019]     136135213 (NXT1)    03009 Ribosome biogenesis [BR:pphc03009]     136135213 (NXT1) Messenger RNA biogenesis [BR:pphc03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      136135213 (NXT1) Ribosome biogenesis [BR:pphc03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     136135213 (NXT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Motif Other DBs NCBI-GeneID:  136135213 NCBI-ProteinID:  XP_065749177 LinkDB All DBs Position 15:43388325..43388981 Genome browser AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAC NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgtggacttcaagacctatgtggaccaggcctgccgtgccgctgaggagttc gtgaacgtgtactacaccaccatggacaagagacggcggctgctgtcccgcctgtacatg ggcacggccaccttggtgtggaacggcaacgccgtttcgggacaagagtccttgagtgag ttttttgagatgctgccttccagtgagttccaaatcaacgtggtagactgccagcccgtt cacgatgaagccaccccgagccagaccacggtcctcgtggtgatctgtgggacagtgaag tttgagggcaacaaacagcgggacttcaaccagaacttcatcctgacagcccaggcctcg cccagcaacacagtgtggaagattgccagcgactgcttccggttccaggactgggcctgc tag

DBGET integrated database retrieval system