Phocoena phocoena (harbor porpoise): 136137940 Help Entry 136137940         CDS       T11058                                  Name (RefSeq) C-C motif chemokine 4 isoform X1   KO K12964   C-C motif chemokine 4 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04062   Chemokine signaling pathway pphc04064   NF-kappa B signaling pathway pphc04620   Toll-like receptor signaling pathway pphc04623   Cytosolic DNA-sensing pathway pphc05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     136137940   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136137940    04061 Viral protein interaction with cytokine and cytokine receptor     136137940  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     136137940    04623 Cytosolic DNA-sensing pathway     136137940    04062 Chemokine signaling pathway     136137940  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     136137940  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136137940 Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Chemokines    136137940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  136137940 NCBI-ProteinID:  XP_065752418 LinkDB All DBs Position 19:25794386..25796153 Genome browser AA seq 92 aa AA seqDB search MKLCMTVLSFLVLAAAFCSLALSAPMGSDPPTACCFSYTVRKLPRNFVIDYYETSSLCSQ PAVVFQTRKGRQVCANPSDPWVQEYMDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatgactgtcctctccttcctcgtgctcgcagctgctttctgctctctg gcactctcagcaccaatgggctcagaccctcccactgcctgctgcttctcttacaccgtg cggaagctgcctcgcaactttgtgatcgattattacgagaccagcagtctctgctcccag ccagctgtggtattccaaaccagaaagggcaggcaggtgtgcgccaaccccagtgatccc tgggtccaggagtacatggatgaccttgaactgaactga

DBGET integrated database retrieval system