Phocoena phocoena (harbor porpoise): 136138445 Help Entry 136138445         CDS       T11058                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04015   Rap1 signaling pathway pphc04810   Regulation of actin cytoskeleton pphc05014   Amyotrophic lateral sclerosis pphc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     136138445 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136138445 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     136138445 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     136138445 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pphc04131]     136138445 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pphc04812]     136138445 (PFN1)    04147 Exosome [BR:pphc04147]     136138445 (PFN1) Membrane trafficking [BR:pphc04131]  Others   Actin-binding proteins    Others     136138445 (PFN1) Cytoskeleton proteins [BR:pphc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      136138445 (PFN1) Exosome [BR:pphc04147]  Exosomal proteins   Proteins found in most exosomes    136138445 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Pombe_5TM Motif Other DBs NCBI-GeneID:  136138445 NCBI-ProteinID:  XP_065753197 LinkDB All DBs Position 19:50307275..50310212 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIENLMADGVCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGTLVGKDRSSFF VNGLTLGGQKCSVIRDSLMQEGEFTMDLRTKSTSGAPTFNITVTLTTKTLVLLMGKEGIH GGTINKKCHEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctatatcgaaaacctcatggcggacggggtgtgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtaccctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgatgcag gaaggggaatttaccatggatcttcgtaccaagagcaccagcggagcccccaccttcaat atcactgtcaccctgactaccaagacgctagtcctgctgatgggcaaagaaggtatccac ggtggtacgatcaacaagaaatgtcatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system