Phocoena phocoena (harbor porpoise): 136139079 Help Entry 136139079         CDS       T11058                                  Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04060   Cytokine-cytokine receptor interaction pphc04061   Viral protein interaction with cytokine and cytokine receptor pphc04062   Chemokine signaling pathway pphc04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     136139079   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     136139079    04061 Viral protein interaction with cytokine and cytokine receptor     136139079  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     136139079  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136139079    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136139079 Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Chemokines    136139079 Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Chemokines    136139079 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  136139079 NCBI-ProteinID:  XP_065754066 LinkDB All DBs Position 19:complement(25331053..25335407) Genome browser AA seq 130 aa AA seqDB search MRKVSTAPLCLLLTAAAISTQVLTQPNALRDLFNCCFTFNHKKIPLQRLKSYGITSSQCP QAAVLFRTKLAKDIGADPKEKWVWNYMKHLGQKPHTLKTWTLSATLRPSQRLRNDSSPPG FLSLSWTKLT NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaggaaggtgtccacagcgcctctgtgtctgctgctcacggcagctgccatcagcacc caggtgctcactcagccaaatgcactccgcgacctgttcaactgctgtttcacatttaac cataagaagatccccttgcagaggctgaagagctatggaatcaccagtagccagtgtccg caggcagctgtcctcttcagaaccaaactggccaaggacatcggtgccgacccaaaggag aaatgggtctggaattacatgaaacacctgggtcagaaacctcacaccctgaagacttgg actctttcagccacactaagaccaagccagaggctgagaaatgattcttctcccccaggc ttcctgtctctatcctggactaaattgacctga

DBGET integrated database retrieval system