Phocoena phocoena (harbor porpoise): 136140187 Help Entry 136140187         CDS       T11058                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04010   MAPK signaling pathway pphc04014   Ras signaling pathway pphc04015   Rap1 signaling pathway pphc04024   cAMP signaling pathway pphc04072   Phospholipase D signaling pathway pphc04137   Mitophagy - animal pphc04140   Autophagy - animal pphc04218   Cellular senescence pphc04360   Axon guidance pphc04371   Apelin signaling pathway pphc04625   C-type lectin receptor signaling pathway pphc04810   Regulation of actin cytoskeleton pphc05132   Salmonella infection pphc05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136140187 (RRAS)    04014 Ras signaling pathway     136140187 (RRAS)    04015 Rap1 signaling pathway     136140187 (RRAS)    04371 Apelin signaling pathway     136140187 (RRAS)    04072 Phospholipase D signaling pathway     136140187 (RRAS)    04024 cAMP signaling pathway     136140187 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136140187 (RRAS)    04137 Mitophagy - animal     136140187 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     136140187 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136140187 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136140187 (RRAS)   09158 Development and regeneration    04360 Axon guidance     136140187 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     136140187 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     136140187 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pphc04031]     136140187 (RRAS) GTP-binding proteins [BR:pphc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     136140187 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  136140187 NCBI-ProteinID:  XP_065754341 LinkDB All DBs Position 20:7010267..7013730 Genome browser AA seq 232 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICMVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVWDTHPPPTPPHPPAANDWTSSQSGRLLL VHLLRLLMSGSSSGSLAKLRLNVDEAFEQLVRAVRKYQEQELPPCPPSGRAR NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcttacttcgtgtctgactacgacccc actattgaagactcctacacgaagatctgcatggtggatggcgtcccagcccggctagac attctggacaccgctggccaggaggagttcggtgctatgcgggagcagtacatgcgcgcc ggccatggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagatcctccgagtcaaggaccgagatgacttccccatcgtgttggtc gggaacaaggcagatctggagacacagcgccaggtctgggacacccacccaccccccacc ccaccccacccccccgccgcgaacgactggacctcatctcagtctgggaggctccttctg gtgcacctcctgagactcctcatgtcaggatcctcctctggctccctcgccaaactgcgc ctcaatgtggatgaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaa gagctcccgccctgccctcccagcggcagggcacgctga

DBGET integrated database retrieval system