Phocoena phocoena (harbor porpoise): 136140274
Help
Entry
136140274 CDS
T11058
Symbol
FXYD5
Name
(RefSeq) FXYD domain-containing ion transport regulator 5
KO
K13362
FXYD domain-containing ion transport regulator 5
Organism
pphc Phocoena phocoena (harbor porpoise)
Brite
KEGG Orthology (KO) [BR:
pphc00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pphc02000
]
136140274 (FXYD5)
Transporters [BR:
pphc02000
]
Other transporters
Pores ion channels [TC:
1
]
136140274 (FXYD5)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP1G1_PLM_MAT8
DUF3040
Motif
Other DBs
NCBI-GeneID:
136140274
NCBI-ProteinID:
XP_065754423
LinkDB
All DBs
Position
20:complement(16189860..16200831)
Genome browser
AA seq
153 aa
AA seq
DB search
MSPFGRLCLLVFVGLILPTREATPNQMEIHTQQPTEMDVLLTTGPGTDKSRTQVVFCFPP
RLTPALHHLLATLSADPTQGPTPPKTQLPRKNVRTDPALRQTGSSEDDPFSYDEGTLRKR
GLLVAAVLFITGIVILTSGKCRQLPRLCRSHDR
NT seq
462 nt
NT seq
+upstream
nt +downstream
nt
atgtcgccctttggtcgcctgtgtctcctggtcttcgttggcctgattctccccaccaga
gaagcaaccccgaaccagatggagatccacacccagcaaccgacggaaatggatgtgctt
ctaacaacaggtccggggacagacaagagcaggacgcaagttgtcttttgtttccctcca
cggctcactcctgccctccaccatcttctggccactctctctgctgatcccactcaaggc
cccacgccccccaagacccaactcccacgcaaaaacgtcaggacggaccccgccctcagg
cagactggttcaagcgaggacgaccccttctcctatgatgagggcaccctccggaaacgg
ggcctgttggtggcagccgtgctgttcatcaccggcatcgtcatcctcaccagcggcaag
tgtaggcagttgccccggttatgccggagtcatgacagatga
DBGET
integrated database retrieval system