Phocoena phocoena (harbor porpoise): 136140462 Help Entry 136140462         CDS       T11058                                  Name (RefSeq) metallothionein-1E-like   KO K14739   metallothionein 1/2 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pphc00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     136140462  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pphc03019]     136140462    03029 Mitochondrial biogenesis [BR:pphc03029]     136140462 Messenger RNA biogenesis [BR:pphc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      136140462 Mitochondrial biogenesis [BR:pphc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     136140462 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  136140462 NCBI-ProteinID:  XP_065754657 LinkDB All DBs Position 20:complement(30601450..30602935) Genome browser AA seq 61 aa AA seqDB search MDPKCSCPTGGSCGCAGSCTCKACRCTSCKKSRCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaagtgctcctgccccactggcggctcctgcggctgcgctggctcctgcacc tgcaaagcctgcagatgcacctcctgcaagaagagccgctgctcctgctgccccgtgggc tgcgccaagtgtgcccagggctgcgtctgcaaaggggcctcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system