Phocoena phocoena (harbor porpoise): 136141062 Help Entry 136141062         CDS       T11058                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04010   MAPK signaling pathway pphc04014   Ras signaling pathway pphc04015   Rap1 signaling pathway pphc04020   Calcium signaling pathway pphc04151   PI3K-Akt signaling pathway pphc04714   Thermogenesis pphc04810   Regulation of actin cytoskeleton pphc05200   Pathways in cancer pphc05218   Melanoma pphc05224   Breast cancer pphc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136141062 (FGF21)    04014 Ras signaling pathway     136141062 (FGF21)    04015 Rap1 signaling pathway     136141062 (FGF21)    04020 Calcium signaling pathway     136141062 (FGF21)    04151 PI3K-Akt signaling pathway     136141062 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     136141062 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     136141062 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136141062 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     136141062 (FGF21)    05218 Melanoma     136141062 (FGF21)    05224 Breast cancer     136141062 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pphc04052]     136141062 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:pphc00536]     136141062 (FGF21) Cytokines and neuropeptides [BR:pphc04052]  Cytokines   Growth factors (RTK binding)    136141062 (FGF21) Glycosaminoglycan binding proteins [BR:pphc00536]  Heparan sulfate / Heparin   Growth factors/receptors    136141062 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  136141062 NCBI-ProteinID:  XP_065755278 LinkDB All DBs Position 20:complement(7536969..7538621) Genome browser AA seq 208 aa AA seqDB search MGWDKTKFEHLGLWVPVLAVLLGPCQAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHL EIRADGTVVGTARRSPESLLELKALKPGVIQILGVKTSRFLCQGPEGRLYGSLHFNPQAC SFRELLLEDGYNVYQSEALGIPLRLPPHRSSNRDLAPRGPARFLPLPGFLPPPLEPPGIL APEPPNVGSSDPLSMVGPSHGRSPSYTS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgggctgggacaagaccaaattcgagcacctgggactgtgggtccctgtgctagctgtc ctgctgggaccctgccaggcacatcccattcctgactccagccccctcctccaatttggg ggccaagtccgccagcgatacctctacacagatgacgcccaggagacggaggcccacctg gagatcagggctgatggcacagtggtggggacggcccgccggagccccgaaagtcttctg gagctgaaagccctaaagccaggggtcattcaaatcttgggagttaaaacatccaggttc ttgtgccagggaccagaggggaggctgtatggatcgctccacttcaacccccaggcctgc agcttccgggagctgcttcttgaggatggatacaacgtttaccagtctgaggctcttggc attcccctccgcctgcccccacaccgctcctccaaccgggacctggccccccggggacct gctcgcttcctgccgctgccaggcttcctcccgccacccctggagcctccagggatcttg gccccggagcctcccaacgtgggctcctcagaccccttgagcatggtgggaccttcacat ggccgaagccccagctacacttcctga

DBGET integrated database retrieval system