Pantoea phytostimulans: ACF2G4_03020 Help Entry ACF2G4_03020      CDS       T11029                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pphi  Pantoea phytostimulans Pathway pphi01100   Metabolic pathways pphi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pphi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACF2G4_03020    00074 Mycolic acid biosynthesis     ACF2G4_03020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACF2G4_03020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3051 Motif Other DBs NCBI-ProteinID:  XLQ80443 LinkDB All DBs Position 635138..635392 Genome browser AA seq 84 aa AA seqDB search MMNKDEIYQEVASLLTNLFEIEADDIRPDARLYEDLELDSIDAVDMVVHLQKRTGRKIKP ETFRSVRTVQDVVDAVEQLMREGA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatgaacaaagatgaaatttatcaggaagtcgcctcattgctgactaacctgtttgaa attgaggcggatgacattcgcccggacgcacgcctttacgaagatttggaactcgacagc attgatgcggttgatatggtggttcacctgcaaaaacgtactggccgtaaaatcaaacca gaaactttccgttcggtacgtaccgtgcaggatgtggtggatgcggtagaacagttgatg cgcgaaggcgcctga

DBGET integrated database retrieval system