Pantoea phytostimulans: ACF2G4_03335 Help Entry ACF2G4_03335      CDS       T11029                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pphi  Pantoea phytostimulans Pathway pphi01100   Metabolic pathways pphi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pphi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACF2G4_03335 (acpP)    00074 Mycolic acid biosynthesis     ACF2G4_03335 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACF2G4_03335 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 HLH NirdL-like_HTH DUF1493 Motif Other DBs NCBI-ProteinID:  XLQ80504 LinkDB All DBs Position 695847..696083 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIIGEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcattggtgagcagctgggtgtgaaagag gaagaagtaaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggttatggctctggaagaagagtttgatactgaaattccagacgaagaagct gagaaaatcaccaccgttcaggcagcgatcgactatatcaatagccacaaagcctaa

DBGET integrated database retrieval system