KEGG   Pantoea phytostimulans: ACF2G4_13440
Entry
ACF2G4_13440      CDS       T11029                                 
Name
(GenBank) GNAT family N-acetyltransferase
  KO
K09919  uncharacterized protein
Organism
pphi  Pantoea phytostimulans
Brite
KEGG Orthology (KO) [BR:pphi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ACF2G4_13440
SSDB
Motif
Pfam: FemAB_like Acetyltransf_6
Other DBs
NCBI-ProteinID: XLQ78995
LinkDB
Position
complement(2869307..2870431)
AA seq 374 aa
MSLIHLTSLAEIAAAEWDALLPDDQPFLRHAFLSSLEESGSVRAESGWQPDHLLWRENGV
LRAAIPGYRKRHSQGEYVFDHVWADASQRAGIRYYPKWLGAIPFSPVTGARLIGAPDAAA
QLLAALPETLLKNGLSGAHINFTDAQANHLLHEQPNWLERWGLQYHWHNRGYRDFQDFLD
TLMSRKRKQLRKEREQVTQSGFEFSGYRGDQLREDQWDFVYTCYANTYAVRGQRPYLTRN
FFSLLAERMPENIRVVIAHLQQQPAAMAFYLKDEHALYGRYWGCLAEFDRLHFETCFYQG
MDFAIAEGLQRFDAGAQGEHKLVRGFEPHITHSWHYLMHPGLREAVDDFLQREREGVRAW
EEEARDALPYRRGD
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcactgattcacctgacttcgttagcagagattgctgccgccgaatgggatgcgctg
ttacctgatgatcaaccttttttacgccacgcctttctgtctagtctggaggagagcggc
agcgtgcgcgctgaatcgggctggcaaccggatcatctgctgtggcgtgaaaacggcgtg
ctgcgcgctgctattcctggctatcgcaagcgtcactcgcagggcgaatatgtatttgat
catgtatgggccgatgccagccagcgtgcaggaatccgttattatccaaaatggcttggg
gccattccattcagtccggtaacgggcgcacgtctgattggcgcgcccgacgcggcggcg
caattgctggcagccttaccggaaacactgctaaaaaacggattgagcggcgcgcacatt
aattttaccgatgcgcaggccaatcatctgctgcacgagcagcccaactggcttgaacgc
tggggcctgcagtatcactggcacaatcgcggctaccgcgactttcaggatttcctcgac
acgttgatgtcacgcaagcgtaaacagctgcgcaaagagcgtgaacaggtgacgcagagt
ggctttgaattcagcgggtatcgcggcgatcagctccgtgaagatcagtgggattttgtg
tatacctgttacgccaacacttacgcagtgcgcggccagcggccctatttaacgcgcaat
ttctttagtttgctggcggagcggatgccagaaaatatccgcgtggtgattgcgcacctt
cagcagcagcccgcagcgatggcgttttacctcaaagatgaacacgcactgtatggacgt
tattggggatgtttagccgaatttgaccggctgcattttgaaacctgtttctatcaggga
atggattttgccattgcagaaggattgcagcgttttgatgcgggcgcacaaggcgaacat
aaactggtgcgcggctttgagccgcatattacccactcgtggcattacttaatgcatccg
ggattacgtgaagcggtggatgattttcttcagcgagaaagggagggcgtacgcgcctgg
gaagaggaggcgcgcgacgccttgccctatcgacgcggtgattaa

DBGET integrated database retrieval system