Pantoea phytobeneficialis: CTZ24_07615 Help Entry CTZ24_07615       CDS       T09899                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppho  Pantoea phytobeneficialis Pathway ppho01100   Metabolic pathways ppho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTZ24_07615    00074 Mycolic acid biosynthesis     CTZ24_07615   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTZ24_07615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QGR06278 UniProt:  A0AAP9H4A0 LinkDB All DBs Position 1640247..1640504 Genome browser AA seq 85 aa AA seqDB search MQSLNNEIKQMIIDTLNLEDISVDDIDTDAPLFGEGLGLDSIDALELGLAVKNRFSVQLS AESETLRAHFFSVATLAAFIEQQQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaatcactgaacaacgaaataaaacaaatgattatcgacacgctgaatctggaagat atcagcgttgatgatattgacaccgatgcccccctgttcggcgagggactggggctggac tccatcgatgctctggagctgggactggcggtaaagaatcgttttagcgttcagctctcc gctgaaagtgaaacgttgcgcgcgcactttttttccgtggccacgctggctgcgtttatt gaacaacagcaagcctga

DBGET integrated database retrieval system