Pantoea phytobeneficialis: CTZ24_07765 Help Entry CTZ24_07765       CDS       T09899                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ppho  Pantoea phytobeneficialis Brite KEGG Orthology (KO) [BR:ppho00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ppho03400]     CTZ24_07765 DNA repair and recombination proteins [BR:ppho03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     CTZ24_07765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Kelch_KLHDC2_KLHL20_DRC7 DUF5374 Motif Other DBs NCBI-ProteinID:  QGR06306 UniProt:  A0AAP9H495 LinkDB All DBs Position complement(1670967..1671212) Genome browser AA seq 81 aa AA seqDB search MRVEITVAKTQPLPAGALDALSAELTRRISRDFPDDEHHVKVRYASGNQLSVFGGCKENR ERISDILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaaattaccgtagcaaaaactcagccccttcctgcgggcgcactggatgcg ttaagcgcagagcttacccgccgcatctcccgtgatttcccagacgatgaacatcacgtc aaagttcgctatgccagcggcaatcaactgagcgtttttggtggttgcaaagaaaatcgc gaacgtatcagcgatattttacaggaaacctgggaaagcgctgacgactggtttattacc gattaa

DBGET integrated database retrieval system