Pannonibacter phragmitetus: APZ00_11300 Help Entry APZ00_11300       CDS       T04214                                  Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pphr  Pannonibacter phragmitetus Pathway pphr00362   Benzoate degradation pphr00621   Dioxin degradation pphr00622   Xylene degradation pphr01100   Metabolic pathways pphr01120   Microbial metabolism in diverse environments pphr01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:pphr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     APZ00_11300    00622 Xylene degradation     APZ00_11300    00621 Dioxin degradation     APZ00_11300 Enzymes [BR:pphr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      APZ00_11300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  ALV27582 UniProt:  A0A0U3FN01 LinkDB All DBs Position 2418178..2418393 Genome browser AA seq 71 aa AA seqDB search MPYVNIKITREGATAGQKARLIEGVTRLLADVLDKNPATTFVVIDEVAMEDWGIGGLPVA EYRKTLASGPA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccttatgtgaacatcaagatcacccgcgaaggggcaacggccggccagaaggcccgc cttatcgaaggggtgacccgtcttcttgccgatgtgctggacaagaacccggcaaccact tttgtcgtcattgacgaggtggcaatggaagactggggcatcggcggccttccggtggcc gaataccgcaagaccctcgccagcggccctgcctga

DBGET integrated database retrieval system