Pannonibacter phragmitetus: APZ00_18175 Help Entry APZ00_18175       CDS       T04214                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism pphr  Pannonibacter phragmitetus Pathway pphr02024   Quorum sensing pphr03018   RNA degradation Brite KEGG Orthology (KO) [BR:pphr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     APZ00_18175  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     APZ00_18175  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pphr03019]     APZ00_18175    03036 Chromosome and associated proteins [BR:pphr03036]     APZ00_18175 Messenger RNA biogenesis [BR:pphr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      APZ00_18175 Chromosome and associated proteins [BR:pphr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     APZ00_18175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 ALOG_dom Motif Other DBs NCBI-ProteinID:  ALV28743 UniProt:  A0A0L0J4F2 LinkDB All DBs Position 3977699..3977956 Genome browser AA seq 85 aa AA seqDB search MAERAQNLQDTFLNYLRKQKVPLTIFLINGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHA ISTIMPNGPVQLFEGGEEGAEKAGA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctgagcgtgcacagaatctgcaggacaccttcctcaactaccttcgcaagcagaaa gttccgctgacgatcttcctcatcaacggcgtgaagctgcagggcgtggtgacgtggttt gataatttctgtgttcttttgcgccgggatggtcattcccagcttgtctacaagcatgcc atttcgaccatcatgccgaacggccccgtgcagctgttcgaaggcggtgaagaaggcgcc gaaaaagcaggcgcctga

DBGET integrated database retrieval system