Pannonibacter phragmitetus: APZ00_19190 Help Entry APZ00_19190       CDS       T04214                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pphr  Pannonibacter phragmitetus Pathway pphr01100   Metabolic pathways pphr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pphr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APZ00_19190    00074 Mycolic acid biosynthesis     APZ00_19190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APZ00_19190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ALV28906 UniProt:  A0A0L0J030 LinkDB All DBs Position complement(4217918..4218154) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIEHLGVDADKVVEAASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFLEKNAG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcggaacgagttaagaagatcgttatcgagcacctgggcgtcgacgcc gacaaggtcgtcgaagctgcaagcttcatcgacgacctcggcgcggacagccttgacacc gtcgagctggtgatggccttcgaagaagaattcggcgtcgagatccccgacgatgcagcc gagacgatcctgaccgtcggcgacgcggtcaagttcctcgaaaagaacgccggttaa

DBGET integrated database retrieval system