Pannonibacter phragmitetus: APZ00_22890 Help Entry APZ00_22890       CDS       T04214                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism pphr  Pannonibacter phragmitetus Pathway pphr00190   Oxidative phosphorylation pphr01100   Metabolic pathways pphr02020   Two-component system Module pphr_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:pphr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     APZ00_22890  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     APZ00_22890 Enzymes [BR:pphr01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      APZ00_22890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ALV29538 UniProt:  A0A0L0J6Z3 LinkDB All DBs Position complement(5021992..5022105) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGMPLACCLAILNAMWLEMREDTEKQKKAS NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcctggatcctcggtatgcctctggcctgctgcctcgccatcctcaac gccatgtggcttgaaatgcgcgaggacaccgaaaagcagaagaaggcaagctga

DBGET integrated database retrieval system