Candidatus Pelagisphaera phototrophica: GA004_06415 Help Entry GA004_06415       CDS       T09061                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppht  Candidatus Pelagisphaera phototrophica Pathway ppht01100   Metabolic pathways ppht01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppht00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GA004_06415    00074 Mycolic acid biosynthesis     GA004_06415   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GA004_06415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 Ribosomal_L50 PP-binding_2 DUF366 CCDC22_N Motif Other DBs NCBI-ProteinID:  QXD33336 LinkDB All DBs Position 1455697..1455957 Genome browser AA seq 86 aa AA seqDB search MADEKSIEQRVSEIIVNQLNVNEEQITPEASFLDDLGADSLDTVELIMAFEEEFKDEIQG EIPESDAEKLQTVGDVTSYIKEKAGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggctgacgaaaaaagcatcgaacaaagagtctcagaaatcatcgtaaaccagctcaac gttaacgaagagcagatcacgccggaagcctccttcctcgatgatcttggagctgattca ctcgacaccgttgagttgattatggcatttgaagaagagtttaaagacgagatccaaggt gaaatcccggagtctgacgcggaaaagctgcagacggtcggtgacgtcacttcttacatt aaagagaaagcgggagcttaa

DBGET integrated database retrieval system