Pseudomonas putida ND6: YSA_01905 Help Entry YSA_01905         CDS       T02170                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppi  Pseudomonas putida ND6 Pathway ppi01100   Metabolic pathways ppi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YSA_01905    00074 Mycolic acid biosynthesis     YSA_01905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YSA_01905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Fas_alpha_ACP Ribosomal_L50 DUF1493 HLH DUF6952 Motif Other DBs NCBI-ProteinID:  AFK67805 UniProt:  I3UQN4 LinkDB All DBs Position complement(1020260..1020496) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTIEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVKAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaagaagtgactattgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgaactggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaaagcccaccaggcctaa

DBGET integrated database retrieval system