Pseudomonas putida ND6: YSA_03900 Help Entry YSA_03900         CDS       T02170                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ppi  Pseudomonas putida ND6 Pathway ppi02024   Quorum sensing ppi03018   RNA degradation Brite KEGG Orthology (KO) [BR:ppi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     YSA_03900  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     YSA_03900  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppi03019]     YSA_03900    03036 Chromosome and associated proteins [BR:ppi03036]     YSA_03900 Messenger RNA biogenesis [BR:ppi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      YSA_03900 Chromosome and associated proteins [BR:ppi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     YSA_03900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AFK68875 UniProt:  I3UTQ4 LinkDB All DBs Position complement(2086011..2086271) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAIS TVVPARPVRLPSPTDSEHGDSEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaataccttgagaaaagaaaaggtc ccggtatccatttacctggtcaacggtatcaaactgcagggctcgatcgagtcgttcgac cagttcgtggtattgctgaagaacaccgtcagccagatggtctacaagcacgccatctcg accgtagttccggcccgtccggtccgcctgccaagcccgaccgacagcgagcacggcgac agcgagccaggcaacgcctga

DBGET integrated database retrieval system