Pseudomonas putida ND6: YSA_04533 Help Entry YSA_04533         CDS       T02170                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism ppi  Pseudomonas putida ND6 Brite KEGG Orthology (KO) [BR:ppi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppi03036]     YSA_04533 Chromosome and associated proteins [BR:ppi03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     YSA_04533 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ADIP Filament ZapB_rel Asd-4 TPR_MLP1_2 ZapB Motif Other DBs NCBI-ProteinID:  AFK69227 UniProt:  I3UUQ6 LinkDB All DBs Position 2463930..2464148 Genome browser AA seq 72 aa AA seqDB search MQPTQENDLQALMSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKVES MILRLKALEQDS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgcaacccacgcaagagaacgacctgcaggcactgatgagccgattcgagttgctgatc gaacgcgtcgagcaactaaaacggcaaaatgcactcctagtagctcaggaaaaatcctgg cgcgaagagcgcgcccacctcatcgaaaagaacgagatcgccaagcgcaaagtcgagtcg atgattttacgcctcaaggctctggagcaagactcatga

DBGET integrated database retrieval system