Pseudomonas putida ND6: YSA_08098 Help Entry YSA_08098         CDS       T02170                                  Name (GenBank) Hpt protein   KO K20976   histidine phosphotransfer protein HptB Organism ppi  Pseudomonas putida ND6 Pathway ppi02020   Two-component system ppi02025   Biofilm formation - Pseudomonas aeruginosa Brite KEGG Orthology (KO) [BR:ppi00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     YSA_08098  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     YSA_08098  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02022 Two-component system [BR:ppi02022]     YSA_08098 Two-component system [BR:ppi02022]  Other families   SagS-HptB-HsbR (swarming activity and biofilm formation)    YSA_08098 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hpt DUF1707 Motif Other DBs NCBI-ProteinID:  AFK71150 UniProt:  I3V079 LinkDB All DBs Position 4374561..4374908 Genome browser AA seq 115 aa AA seqDB search MTDMHIDHKVLSDLREVMEDGYLQLVQTFLDDSERRLGQLHAAKSAEELGAAAHSFKGSS SNMGAVALASLCQQLEERARRPPLYGIEDLISRIDMEFVVVQHFYRGEQQRISAG NT seq 348 nt NT seq  +upstreamnt  +downstreamnt gtgactgacatgcatattgaccacaaggtactcagtgacctgcgtgaggtcatggaagat ggctacctgcagttggtgcagacttttctcgacgactcagagcggcgtcttggccagctg cacgcggccaaaagcgccgaggagcttggcgcggcagcccacagtttcaagggcagcagc agcaacatgggcgcggtggccttggccagcctgtgccagcagctcgaagagcgcgcacgg cggcccccgttatatggaattgaagacttgatcagccgcatcgacatggaattcgtcgtg gtgcagcacttttaccgcggtgagcagcaacgtatttccgcaggctga

DBGET integrated database retrieval system