Pseudomonas piscis: QL104_08195 Help Entry QL104_08195       CDS       T09652                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppii  Pseudomonas piscis Pathway ppii01100   Metabolic pathways ppii01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppii00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QL104_08195    00074 Mycolic acid biosynthesis     QL104_08195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QL104_08195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RexA PP-binding Motif Other DBs NCBI-ProteinID:  WMN19378 UniProt:  U6ZQC1 LinkDB All DBs Position complement(1731231..1731494) Genome browser AA seq 87 aa AA seqDB search MDRFDIQQSIRQAIEAQMAQKWRTPPSQAQTSDTYSLDLKALLHSLENEFDIRLDAEHDL YWIHSISELSLFILEKTRRRDLRPMHP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaccgtttcgacatccagcaaagcatccgccaggccatcgaagcccaaatggcgcag aaatggcggacccctcccagccaggcgcaaaccagcgacacctactccctggacctcaag gccctgttgcacagcctggaaaacgagttcgacatccgactcgacgccgaacacgacctg tactggatccactccatcagcgagctgagcctgttcatcctggaaaagacccggcgccgg gaccttcgccccatgcatccgtga

DBGET integrated database retrieval system