Photobacterium piscicola: ACJZU6_03040
Help
Entry
ACJZU6_03040 CDS
T11087
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
ppil Photobacterium piscicola
Pathway
ppil03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
ppil00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
ACJZU6_03040 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
ppil03011
]
ACJZU6_03040 (rplR)
Ribosome [BR:
ppil03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
ACJZU6_03040 (rplR)
Bacteria
ACJZU6_03040 (rplR)
Archaea
ACJZU6_03040 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
TM1506
Motif
Other DBs
NCBI-ProteinID:
XLM58640
LinkDB
All DBs
Position
1:624679..625032
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKASRIRRATRARRKIAELGATRLVVHRTPRHVYAQVIAPNGSEVIAAASTLEKAIRE
QVKSTGNKDAAAVVGKTIAERAIEKGISNVAFDRSGFQYHGRIATLAEAAREAGLKF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaagcatctcgtatccgtcgtgcgacccgagcacgtcgtaagattgctgaa
ctgggcgcaactcgcctagttgtacaccgtactccacgtcacgtgtacgctcaggtaatc
gcaccgaacggctctgaggttatcgcagccgcttctactttagaaaaagcgatccgtgag
caagttaagagtaccggaaacaaagacgctgctgcagttgtaggtaaaactattgctgag
cgcgcgattgaaaaaggcatctctaacgttgcatttgatcgctctggtttccaataccac
ggccgtatcgcgacactagcagaagctgctcgtgaagctggtctgaaattctaa
DBGET
integrated database retrieval system