Photobacterium piscicola: ACJZU6_03200
Help
Entry
ACJZU6_03200 CDS
T11087
Name
(GenBank) single-stranded DNA-binding protein
KO
K03111
single-strand DNA-binding protein
Organism
ppil Photobacterium piscicola
Pathway
ppil03030
DNA replication
ppil03430
Mismatch repair
ppil03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
ppil00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
ACJZU6_03200
03430 Mismatch repair
ACJZU6_03200
03440 Homologous recombination
ACJZU6_03200
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
ppil03032
]
ACJZU6_03200
03400 DNA repair and recombination proteins [BR:
ppil03400
]
ACJZU6_03200
03029 Mitochondrial biogenesis [BR:
ppil03029
]
ACJZU6_03200
DNA replication proteins [BR:
ppil03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
ACJZU6_03200
DNA repair and recombination proteins [BR:
ppil03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
ACJZU6_03200
TLS (translesion DNA synthesis) factors
Other SOS response factors
ACJZU6_03200
Mitochondrial biogenesis [BR:
ppil03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA replication factors
Other Mitochondrial DNA replication factors
ACJZU6_03200
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSB
SSB_1
Motif
Other DBs
NCBI-ProteinID:
XLM58658
LinkDB
All DBs
Position
1:658595..659161
Genome browser
AA seq
188 aa
AA seq
DB search
MASRGVNKVILIGNLGNDPEIRYMPSGGAVANITIATSESWRDKSTGEQREKTEWHRVAL
FGKLAEVAGEYLRKGSQVYIEGQLQTRKWQNQQGQDQYTTEVVVQGFNGVMQMLGGRNGG
QGAPMGGQQQQQNQGNWGQPQQPAAAPQQNYAPQQPQQHQSAPQQSAPQQPQQQYNEPPM
DFDDDIPF
NT seq
567 nt
NT seq
+upstream
nt +downstream
nt
atggccagtcgtggcgtaaataaagttattttaatcggtaacttaggaaatgatccagaa
attcgttacatgcctagcggtggtgcagtagctaacattactattgcaacctctgagtct
tggcgtgataagtctaccggtgagcaacgtgaaaaaacagaatggcaccgtgtagcattg
tttggcaaattagcagaagtcgcaggtgaatacctacgtaaaggttcacaagtgtacatc
gaaggccaattacaaacacgtaaatggcagaatcaacaaggccaagatcaatacactact
gaagtggttgtgcaaggttttaacggtgtaatgcaaatgctaggcggccgtaatggcggc
caaggtgcaccaatgggtggccaacaacaacagcagaaccaaggtaattggggtcaacct
caacaaccagctgctgcgccacagcaaaattatgcaccacagcagcctcagcaacatcag
tctgcaccacaacagtcagctccacagcaaccacagcaacaatacaatgagccaccaatg
gattttgatgacgatattccgttctag
DBGET
integrated database retrieval system