Photobacterium piscicola: ACJZU6_06790 Help Entry ACJZU6_06790      CDS       T11087                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppil  Photobacterium piscicola Pathway ppil01100   Metabolic pathways ppil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACJZU6_06790 (acpP)    00074 Mycolic acid biosynthesis     ACJZU6_06790 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACJZU6_06790 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB EutQ Motif Other DBs NCBI-ProteinID:  XLM59239 LinkDB All DBs Position 1:1388197..1388430 Genome browser AA seq 77 aa AA seqDB search MSNIEERVRKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVNSAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaagaaaaatcatcgttgagcaactaggcgtagacgaa gcagaagttaaaaacgaagcatctttcgttgatgatctaggtgctgattctctagataca gttgaactagtaatggctcttgaagaagaattcgatacagaaatccctgacgaagaagct gaaaaaattactactgttcaagctgcaatcgactacgtaaacagcgcacagtaa

DBGET integrated database retrieval system