Photobacterium piscicola: ACJZU6_16050 Help Entry ACJZU6_16050      CDS       T11087                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppil  Photobacterium piscicola Pathway ppil01100   Metabolic pathways ppil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACJZU6_16050    00074 Mycolic acid biosynthesis     ACJZU6_16050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACJZU6_16050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XLM60306 LinkDB All DBs Position 2:294507..294764 Genome browser AA seq 85 aa AA seqDB search MTQINNDQIFIQIQDLLVELFELDANDIQPQSNLYQDLDLDSIDAVDLVVRLQNLTGKKI QPDEFKNVRTVNDVVIAVADLLKAE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactcaaatcaataacgaccagatttttatccaaatccaagaccttttagttgaacta tttgaacttgatgccaatgacattcaaccacaatcaaacctttaccaagatctagatctc gatagtattgatgcggttgaccttgttgttcgcttacaaaacctcacaggtaagaaaatc caacctgatgaatttaaaaatgttcgtactgtcaatgatgtcgttatagcggttgctgat ttactcaaggctgaataa

DBGET integrated database retrieval system